DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and LOC108179232

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:212 Identity:47/212 - (22%)
Similarity:68/212 - (32%) Gaps:99/212 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 MCPSGFFYNSTSSKCMVDIRATCVTNIKYCIEGVREEDPNNCAGYRQCIRGLVQNLNCPLGQYFN 816
            :||:||:.||:.   ::.....|.... ||..|.:...|::         ||..| .||...|  
Zfish    36 LCPAGFYCNSSG---LIQPSGNCAPGF-YCAGGAKTAMPDD---------GLTGN-RCPTRYY-- 84

  Fly   817 VAERDCLMDVHKVCARTEEVYKSDEVQHNDTGPPMTKPDESCIRDINGVCVDPLAKCREGQHKLD 881
                         |.:.                                |..|| .|.:|.|   
Zfish    85 -------------CPQG--------------------------------CASPL-HCPDGTH--- 100

  Fly   882 PNNCAGYLKCQNGELIEELCPNGFYYDFLMKICLVDRRGICVTNIQICDEGALEEDPHDCAGYRQ 946
             :|..|..:|.:       ||.|:       :||...      ::|:|.:|      |.|.|   
Zfish   101 -SNSTGSAECSD-------CPTGW-------LCLEGE------DLQLCPKG------HYCVG--- 135

  Fly   947 CIDGQVEN-LKCPFGTY 962
               |.||: |.||.|||
Zfish   136 ---GTVEDILPCPPGTY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 6/16 (38%)
CBM_14 881..914 CDD:279884 6/32 (19%)
LOC108179232XP_021322084.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.