DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31077 and Gm30500

DIOPT Version :9

Sequence 1:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_017171830.1 Gene:Gm30500 / 102632425 MGIID:5589659 Length:614 Species:Mus musculus


Alignment Length:478 Identity:110/478 - (23%)
Similarity:144/478 - (30%) Gaps:166/478 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CPAGSNFNVISKNCQMSRTGSC--ASPKEICLEGELQVDSEDCA-GYLECLNGGLVKEKCPIG-- 179
            ||.|:    .|....:|.:..|  ..|...|....|...|..|| ||. ||:|  |....|.|  
Mouse   113 CPVGT----FSDRMFLSMSSECLPCPPGHFCAASGLSAPSGPCAPGYF-CLSG--VSSPTPTGRS 170

  Fly   180 --------SYFEPIFKLCQLDENGV-----CSSSSSECTDGEVRVDPNNC-AGYFNCENGRLITK 230
                    .:|.|         .|.     |.:.|.....|:|...|  | |||:..||   ||.
Mouse   171 GHGGPCPQGHFCP---------RGTSLPQPCRAGSYGSLLGQVSCFP--CPAGYYCPEN---ITS 221

  Fly   231 ----TCPSGTYFEPTYKTCTVDLKGVCVEPPAKCTEGQLKIDP-----NNCAGYLKCIDGEFVEE 286
                .||:|.|       |....|.....|   |..|....||     ::|   |.|..|.:..:
Mouse   222 YSGYPCPAGFY-------CPRGTKHAAQFP---CPRGYYNPDPLTHSLDSC---LPCPPGHYCGQ 273

  Fly   287 K--------CPGGTYYDFKLETCLVDTEGVCVTIRKLCIEGLREKDPKD---------------- 327
            :        |..|.|                      |:.......|.|                
Mouse   274 ENLTKPSGPCDAGWY----------------------CVSAAWNARPFDLDNYTSTNCLCPATAT 316

  Fly   328 ---CAAYTQCIRGRVESVMCDSGRY-----FNVTQGECLADLYEVCLKSRKEHFRIVEHHQYDES 384
               |.|.:.|..|..|.:.|..|.:     .....|.|.|..:  |:...:....:      ||.
Mouse   317 GGKCPAGSYCPEGSPEPIPCTPGSFCATSGLPTPTGPCQAGYF--CIGGSESPAPV------DEV 373

  Fly   385 T----TPNSYQQTES---TDADFQSTDSALQEVTSQNSCIFDLNGACVGQSTICTEGKKQRDINN 442
            |    .|.||....|   |.... .|.|:|.|.|:.::|     .:| .....|.|...|.....
Mouse   374 TGGPCPPGSYCPVASHKPTPCPV-GTFSSLPEQTTSSTC-----RSC-PSGFYCKEAGLQAPSGW 431

  Fly   443 C-AGYLKCIDG-----EFVEEECPESTYY------DSNLETCLVDNYG-----ACVTSTSICVEG 490
            | |||. |...     :|....||.. ||      .:...:|.|..||     ..:|...:|..|
Mouse   432 CPAGYY-CDSSTGPVQDFSLYPCPRG-YYCPVGTTKAMYHSCPVGTYGPRKGLTSITECQLCPAG 494

  Fly   491 IVEEDPKDC--AGYNQCVRGKVE 511
                  |.|  ||.: ...|||:
Mouse   495 ------KFCSLAGIS-APTGKVQ 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 13/37 (35%)
CBM_14 267..308 CDD:279884 9/53 (17%)
CBM_14 439..472 CDD:279884 10/44 (23%)
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Gm30500XP_017171830.1 TNFRSF 394..518 CDD:389949 34/133 (26%)
CRD1 394..411 CDD:276900 5/17 (29%)
CRD2 414..451 CDD:276900 10/38 (26%)
CRD3 453..506 CDD:276900 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.