DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and ALD5

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_010996.2 Gene:ALD5 / 856804 SGDID:S000000875 Length:520 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:37/211 - (17%)
Similarity:76/211 - (36%) Gaps:80/211 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRTLTCPLPQLEVLM 84
            |:.:|:::|..|:.|.|.:...        .|.|..:.......::|:.           |:.:.
Yeast   333 TVYEEVLQKLKDYTESLKVGDP--------FDEEVFQGAQTSDKQLHKI-----------LDYVD 378

  Fly    85 LNKNE----------------------FSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPF 127
            :.|:|                      |:|:...||::::        .:.| ||    :.:..|
Yeast   379 VAKSEGARLVTGGARHGSKGYFVKPTVFADVKEDMRIVKE--------EVFG-PI----VTVSKF 430

  Fly   128 STY-----LRYDYEY------YSNYIAQSLSKLKFLDHGLVQ-RTYK--YESFPIKNYN----GK 174
            ||.     :..|.:|      ::|.|.:::...|.:..|.|. .||.  :::.|...:.    |:
Yeast   431 STVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINTYNNFHQNVPFGGFGQSGIGR 495

  Fly   175 QL--------IQTTSV 182
            ::        .||.||
Yeast   496 EMGEAALSNYTQTKSV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 8/44 (18%)
leucine-rich repeat 11..32 CDD:275378 3/11 (27%)
leucine-rich repeat 33..54 CDD:275378 3/20 (15%)
leucine-rich repeat 55..79 CDD:275378 1/23 (4%)
leucine-rich repeat 80..106 CDD:275378 7/47 (15%)
ALD5NP_010996.2 ALDH_F1-2_Ald2-like 41..513 CDD:143410 37/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.