Sequence 1: | NP_733184.2 | Gene: | CG31076 / 318582 | FlyBaseID: | FBgn0051076 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010996.2 | Gene: | ALD5 / 856804 | SGDID: | S000000875 | Length: | 520 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 211 | Identity: | 37/211 - (17%) |
---|---|---|---|
Similarity: | 76/211 - (36%) | Gaps: | 80/211 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 TLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRTLTCPLPQLEVLM 84
Fly 85 LNKNE----------------------FSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPF 127
Fly 128 STY-----LRYDYEY------YSNYIAQSLSKLKFLDHGLVQ-RTYK--YESFPIKNYN----GK 174
Fly 175 QL--------IQTTSV 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31076 | NP_733184.2 | LRR_8 | 11..65 | CDD:290566 | 8/44 (18%) |
leucine-rich repeat | 11..32 | CDD:275378 | 3/11 (27%) | ||
leucine-rich repeat | 33..54 | CDD:275378 | 3/20 (15%) | ||
leucine-rich repeat | 55..79 | CDD:275378 | 1/23 (4%) | ||
leucine-rich repeat | 80..106 | CDD:275378 | 7/47 (15%) | ||
ALD5 | NP_010996.2 | ALDH_F1-2_Ald2-like | 41..513 | CDD:143410 | 37/211 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |