DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and LRMDA

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001292510.1 Gene:LRMDA / 83938 HGNCID:23405 Length:226 Species:Homo sapiens


Alignment Length:161 Identity:55/161 - (34%)
Similarity:83/161 - (51%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRTL 73
            :|:..:.|:.|.:|:.|.:......::||||.|.|:.|..|:.|..|..|:||:|::.:    .|
Human     9 TQVSYIGQDCREIPEHLGRDCGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNQLGD----DL 69

  Fly    74 TCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPD---GLELQPFSTYLRYD 134
            ..| ||:|..|.||||..:||...:..:.:..|.|:||||.||..||:   .||..      ..|
Human    70 VLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKD------EED 128

  Fly   135 YEYYSNYIAQSLSKLKFLDHGLVQRTYKYES 165
            |:.|..::...|..|||||...|.|..:.|:
Human   129 YKRYRCFVLYKLPNLKFLDAQKVTRQEREEA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 18/53 (34%)
leucine-rich repeat 11..32 CDD:275378 4/20 (20%)
leucine-rich repeat 33..54 CDD:275378 9/20 (45%)
leucine-rich repeat 55..79 CDD:275378 8/24 (33%)
leucine-rich repeat 80..106 CDD:275378 8/25 (32%)
LRMDANP_001292510.1 LRR_RI <27..>113 CDD:238064 33/89 (37%)
leucine-rich repeat 34..54 CDD:275378 9/19 (47%)
LRR_8 53..112 CDD:290566 23/62 (37%)
LRR_4 54..93 CDD:289563 17/42 (40%)
leucine-rich repeat 55..76 CDD:275378 8/24 (33%)
leucine-rich repeat 77..103 CDD:275378 8/25 (32%)
leucine-rich repeat 104..142 CDD:275378 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55867
OrthoDB 1 1.010 - - D1133053at2759
OrthoFinder 1 1.000 - - FOG0008175
OrthoInspector 1 1.000 - - otm41579
orthoMCL 1 0.900 - - OOG6_106345
Panther 1 1.100 - - LDO PTHR46282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5168
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.