DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and MESK4

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001262650.1 Gene:MESK4 / 64872 FlyBaseID:FBgn0043069 Length:280 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:76/148 - (51%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NDSQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLR 71
            ::.::.|..:||:|:|:.|..|.|...:.||||||..::|.:|:.||.|..|:||.|    .:|.
  Fly    85 DNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRN----VNLD 145

  Fly    72 TLTCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDY 135
            ..|.| ||.|.:|.:|..:.:::...:..|.:..|.|..||..|||    |:...       :..
  Fly   146 INTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNP----GIRTV-------FGG 199

  Fly   136 EYYSNYIAQSLSKLKFLD 153
            :....||.|.|.:||:||
  Fly   200 QGPREYILQVLPQLKYLD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 23/53 (43%)
leucine-rich repeat 11..32 CDD:275378 8/20 (40%)
leucine-rich repeat 33..54 CDD:275378 9/20 (45%)
leucine-rich repeat 55..79 CDD:275378 9/24 (38%)
leucine-rich repeat 80..106 CDD:275378 4/25 (16%)
MESK4NP_001262650.1 leucine-rich repeat 111..132 CDD:275378 9/20 (45%)
leucine-rich repeat 133..154 CDD:275378 9/24 (38%)
leucine-rich repeat 155..181 CDD:275378 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D438561at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41579
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.