DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and ALDH8A1

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_072090.1 Gene:ALDH8A1 / 64577 HGNCID:15471 Length:487 Species:Homo sapiens


Alignment Length:35 Identity:8/35 - (22%)
Similarity:18/35 - (51%) Gaps:4/35 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSL 112
            |::.::....::    ||..|:.:...|:.:.|||
Human   222 PEVPLISFTGSQ----PTAERITQLSAPHCKKLSL 252

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566
leucine-rich repeat 11..32 CDD:275378
leucine-rich repeat 33..54 CDD:275378