DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and lrmda

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001018537.1 Gene:lrmda / 553730 ZFINID:ZDB-GENE-050522-285 Length:234 Species:Danio rerio


Alignment Length:159 Identity:53/159 - (33%)
Similarity:81/159 - (50%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NDSQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLR 71
            |.||:..:..:...:|..|..|:.....:||||.|.|:.|:.|..|.||..|::|:|.:.    .
Zfish    11 NGSQVSCIGHDWEDIPDFLGTKYGQMARRLDLSFNQLRSLTGLKAFSQLEELIVDNNLLG----N 71

  Fly    72 TLTCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDY 135
            .|..| ||:|..|.||||:.:|:...:..:.:..|.|:||||.||..||:.|......   ..||
Zfish    72 DLRLPRLPRLHTLTLNKNQLTDIEALLEHLVEVTPALEYLSLLGNEACPNQLVSMDKD---EDDY 133

  Fly   136 EYYSNYIAQSLSKLKFLDHGLVQRTYKYE 164
            :.|..::...|:.|||||   .:|..::|
Zfish   134 QRYRYFVLHKLTNLKFLD---TRRVTQWE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 17/53 (32%)
leucine-rich repeat 11..32 CDD:275378 3/20 (15%)
leucine-rich repeat 33..54 CDD:275378 9/20 (45%)
leucine-rich repeat 55..79 CDD:275378 7/24 (29%)
leucine-rich repeat 80..106 CDD:275378 7/25 (28%)
lrmdaNP_001018537.1 leucine-rich repeat 38..58 CDD:275378 9/19 (47%)
LRR_9 <40..164 CDD:317038 47/130 (36%)
leucine-rich repeat 59..80 CDD:275378 7/24 (29%)
leucine-rich repeat 81..107 CDD:275378 7/25 (28%)
leucine-rich repeat 108..146 CDD:275378 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5210
OMA 1 1.010 - - QHG55867
OrthoDB 1 1.010 - - D1133053at2759
OrthoFinder 1 1.000 - - FOG0008175
OrthoInspector 1 1.000 - - oto39405
orthoMCL 1 0.900 - - OOG6_106345
Panther 1 1.100 - - LDO PTHR46282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5168
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.