DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and CG12516

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:192 Identity:44/192 - (22%)
Similarity:74/192 - (38%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILVQQNLRTLPQELVKKHADHVEQLD---LSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRT 72
            :||||:   .|.:|:..:....::.||   .:|.|.|......|..:.:.::..|:|:       
  Fly   119 VILVQE---ALAEEIENRVKILMKPLDARVANHPCYKRTLMKIDELRPKTIIGPSDRV------- 173

  Fly    73 LTCPLPQLEVLMLN--KNEF-SDLPT---TMRLIRKFFPNLQ-YLSLHGNPICPDGLELQPFSTY 130
                ||....:|:.  .::| .|.||   ||.:.|..|...| |...:..||....:..:..|:.
  Fly   174 ----LPDATPIMVRDIPHKFLGDGPTGIITMHIFRTPFEATQIYRKEYPLPIASVSIWNERVSSV 234

  Fly   131 LRYDYEYYSNY---------------IAQSLSKLKFLDHGLVQRTYKYESFPIKNYNGKQLI 177
              ||.....|.               |.::....|:  ...:.|.|.||:.||   ||::.|
  Fly   235 --YDVIGMMNLLDTFKINCFTVDMEPIKRAFELRKY--SACIHRGYHYETLPI---NGERKI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 13/56 (23%)
leucine-rich repeat 11..32 CDD:275378 6/20 (30%)
leucine-rich repeat 33..54 CDD:275378 6/23 (26%)
leucine-rich repeat 55..79 CDD:275378 3/23 (13%)
leucine-rich repeat 80..106 CDD:275378 9/31 (29%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 44/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.