DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and CG6661

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster


Alignment Length:189 Identity:35/189 - (18%)
Similarity:61/189 - (32%) Gaps:75/189 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVL-DSNRMHEAHLRTL------ 73
            :::|.|...| :.:||::|.|                .:||..:. |.|.....|||.:      
  Fly   180 RDIRRLLTSL-RANADYLEHL----------------SELRFEIQGDMNVFPSFHLRPMDGFVAA 227

  Fly    74 --------------TCPL---------PQLEV-----LMLNKNEFSDLPTTMRLIRKFFPNLQ-- 108
                          .||.         |.|||     |:....:.:.||:.   :..|.|..:  
  Fly   228 LAPFESVALSSSLALCPALMGNTVLWNPSLEVAPVSYLIFRAFQEAGLPSG---VINFVPANERL 289

  Fly   109 YLSLHGNPICPDGLELQPFSTYLRYDYEYYSNYIAQSLSKLKFLDHGLVQRTYKYESFP 167
            :|....:.:...||..|..:.:.|:.::..|:                  |..:|..||
  Fly   290 FLDTITDAVHFAGLNTQASAAFYRHVHKLVSD------------------RMERYICFP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 11/49 (22%)
leucine-rich repeat 11..32 CDD:275378 4/15 (27%)
leucine-rich repeat 33..54 CDD:275378 2/20 (10%)
leucine-rich repeat 55..79 CDD:275378 9/53 (17%)
leucine-rich repeat 80..106 CDD:275378 7/30 (23%)
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 35/189 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.