DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and U2A

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster


Alignment Length:168 Identity:44/168 - (26%)
Similarity:72/168 - (42%) Gaps:30/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LPQ-ELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLRT---LTCPLPQLE 81
            :|| |.:....|..:.:|||.|.|:.|..|....:|:.|:|::||:    ||.   |...:|.|.
  Fly    31 IPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRI----LRISEGLEEAVPNLG 91

  Fly    82 VLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDYEYYSNYIAQSL 146
            .::|..|...:|.....|:.  |..|:.:.|..||:     ..:|          .|..|:|...
  Fly    92 SIILTGNNLQELSDLEPLVG--FTKLETICLLINPV-----STKP----------NYREYMAYKF 139

  Fly   147 SKLKFLDHGLVQ---RTYKYESFPIKNYNGKQLIQTTS 181
            .:|:.||...::   |....|.|..|  .||.:::..|
  Fly   140 PQLRLLDFRKIKQKDRQAAQEFFRTK--QGKDVLKEIS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 15/44 (34%)
leucine-rich repeat 11..32 CDD:275378 3/11 (27%)
leucine-rich repeat 33..54 CDD:275378 7/20 (35%)
leucine-rich repeat 55..79 CDD:275378 8/26 (31%)
leucine-rich repeat 80..106 CDD:275378 6/25 (24%)
U2ANP_610315.1 LRR_9 1..175 CDD:258718 43/166 (26%)
leucine-rich repeat 22..43 CDD:275380 3/11 (27%)
LRR_4 46..81 CDD:289563 14/38 (37%)
leucine-rich repeat 46..65 CDD:275378 7/18 (39%)
leucine-rich repeat 66..89 CDD:275378 8/26 (31%)
leucine-rich repeat 90..114 CDD:275378 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.