powered by:
Protein Alignment CG31076 and aldh7a1
DIOPT Version :9
Sequence 1: | NP_733184.2 |
Gene: | CG31076 / 318582 |
FlyBaseID: | FBgn0051076 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997889.1 |
Gene: | aldh7a1 / 334197 |
ZFINID: | ZDB-GENE-030131-6129 |
Length: | 511 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 16/67 - (23%) |
Similarity: | 25/67 - (37%) |
Gaps: | 13/67 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 VLDSNRMHEAHLRTLTCPLPQLEVLMLNKNEFSDLPTT----------MRLIRKFFPNLQYLSLH 113
||:.|.:..| :.::||....:.:.|........|..| |.:..:| ..|.|.|.
Zfish 209 VLEQNHLPGA-ICSMTCGGADIGMAMAKDERVGLLSFTGSTHVGKQVAMMVQERF--GRQLLELG 270
Fly 114 GN 115
||
Zfish 271 GN 272
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.