DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and CG31274

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:148 Identity:48/148 - (32%)
Similarity:76/148 - (51%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NDSQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEAHLR 71
            ::.::.|..:||:|:|:.|..|.|...:.||||||..::|.:|:.||.|..|:||.|    .:|.
  Fly    85 DNGRISLAYENLKTIPRRLADKFAAQTKFLDLSHNDFRNLRFLSFFEDLDTLILDRN----VNLD 145

  Fly    72 TLTCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDY 135
            ..|.| ||.|.:|.:|..:.:::...:..|.:..|.|..||..|||    |:...       :..
  Fly   146 INTFPYLPSLRILWINNCDIANITDWIHRIERHCPALDQLSCMGNP----GIRTV-------FGG 199

  Fly   136 EYYSNYIAQSLSKLKFLD 153
            :....||.|.|.:||:||
  Fly   200 QGPREYILQVLPQLKYLD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 23/53 (43%)
leucine-rich repeat 11..32 CDD:275378 8/20 (40%)
leucine-rich repeat 33..54 CDD:275378 9/20 (45%)
leucine-rich repeat 55..79 CDD:275378 9/24 (38%)
leucine-rich repeat 80..106 CDD:275378 4/25 (16%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 9/20 (45%)
leucine-rich repeat 133..154 CDD:275378 9/24 (38%)
leucine-rich repeat 155..181 CDD:275378 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448419
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41579
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.