DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31076 and Aldh4a1

DIOPT Version :9

Sequence 1:	NP_733184.2	Gene:	CG31076 / 318582	FlyBaseID:	FBgn0051076	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	NP_780647.3	Gene:	Aldh4a1 / 212647	MGIID:	2443883	Length:	562	Species:	Mus musculus

Alignment Length:	108	Identity:	19/108 - (17%)
Similarity:	34/108 - (31%)	Gaps:	43/108 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 HEAHLRTLTCPL-------PQLEVLMLNKNEFSDLPTTMRLI-------RKFFPNLQYLSLHGNP 116
            |.:.|:....|:       |:.:.|   :....||...|..|       ..:..::||
Mouse    25 HTSSLKVTNEPILAFSQGSPERDAL---QKALKDLKGQMEAIPCVVGDEEVWTSDIQY------- 79

  Fly   117 ICPDGLELQPFSTYLRYDYEYYSNYIAQSLSKLKFLDHGLVQR 159
                  :|.||:.             |..::|..:.|..|:.|
Mouse    80 ------QLSPFNH-------------AHKVAKFCYADKALLNR 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31076	NP_733184.2	LRR_8	11..65	CDD:290566
		leucine-rich repeat	11..32	CDD:275378
		leucine-rich repeat	33..54	CDD:275378
		leucine-rich repeat	55..79	CDD:275378	3/19 (16%)
		leucine-rich repeat	80..106	CDD:275378	5/32 (16%)
Aldh4a1	NP_780647.3	ALDH_F4-17_P5CDH	31..552	CDD:143441	17/102 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1012
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900