DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and T19D7.6

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_508138.2 Gene:T19D7.6 / 188606 WormBaseID:WBGene00020574 Length:156 Species:Caenorhabditis elegans


Alignment Length:175 Identity:41/175 - (23%)
Similarity:71/175 - (40%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DSQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSW-LADFEQLRHLVLDSNRMHEAHLR 71
            :|.::|....|.::|..::|... .:|:|.|.:|.|.:.|: :..|..|:.|.:.:|::.     
 Worm    24 NSHVVLSGLCLTSIPSTVLKNRT-RIEKLTLDNNVLTENSFNMPKFANLKELSVRNNKIR----- 82

  Fly    72 TLTCPLPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDYE 136
                   .|.||:.|             |:|..||::.|.:..||..|:...            |
 Worm    83 -------NLGVLLAN-------------IQKNCPNIEVLRVKNNPGIPEKFT------------E 115

  Fly   137 YYSNYIAQSLSKLKFLDHGLVQRTYKYESFPIKNYNGKQLIQTTS 181
            .....|::.|.||:.| :||       |:...|.|:|......||
 Worm   116 KEKMLISKVLKKLRVL-NGL-------ETHRQKRYSGCSTDSKTS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 14/54 (26%)
leucine-rich repeat 11..32 CDD:275378 4/20 (20%)
leucine-rich repeat 33..54 CDD:275378 7/21 (33%)
leucine-rich repeat 55..79 CDD:275378 3/23 (13%)
leucine-rich repeat 80..106 CDD:275378 6/25 (24%)
T19D7.6NP_508138.2 leucine-rich repeat 48..70 CDD:275378 7/21 (33%)
leucine-rich repeat 71..97 CDD:275378 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008175
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.