DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and lrmda

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031761589.1 Gene:lrmda / 100491555 XenbaseID:XB-GENE-954850 Length:267 Species:Xenopus tropicalis


Alignment Length:156 Identity:54/156 - (34%)
Similarity:84/156 - (53%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PENNDSQLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKDLSWLADFEQLRHLVLDSNRMHEA 68
            |...|:|:..:.::...:|..|.:|:....::||||.|.|:.|..|..|..|..|:||:|::.: 
 Frog     7 PVVTDTQISYIGKDCTKIPSFLSRKYGHLAKRLDLSFNLLRTLDGLEGFSCLEELILDNNQLDD- 70

  Fly    69 HLRTLTCPLPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRY 133
            |:.  ..|||:|..|.:|||:.:||.:.:..:....|.|:||||.||..||:.| :.|...  ..
 Frog    71 HVS--FPPLPKLHTLTVNKNQLTDLESLLDTLASVAPVLEYLSLLGNQACPNEL-VSPEKD--ED 130

  Fly   134 DYEYYSNYIAQSLSKLKFLDHGLVQR 159
            ||:.|..::...|..|||||...|.|
 Frog   131 DYQRYRYFVLNKLPNLKFLDARKVTR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 17/53 (32%)
leucine-rich repeat 11..32 CDD:275378 3/20 (15%)
leucine-rich repeat 33..54 CDD:275378 9/20 (45%)
leucine-rich repeat 55..79 CDD:275378 8/23 (35%)
leucine-rich repeat 80..106 CDD:275378 7/25 (28%)
lrmdaXP_031761589.1 leucine-rich repeat 37..57 CDD:275378 9/19 (47%)
LRR_9 <39..162 CDD:405295 48/124 (39%)
leucine-rich repeat 58..79 CDD:275378 8/23 (35%)
leucine-rich repeat 80..102 CDD:275378 7/21 (33%)
leucine-rich repeat 107..145 CDD:275378 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I5012
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133053at2759
OrthoFinder 1 1.000 - - FOG0008175
OrthoInspector 1 1.000 - - oto104219
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.