DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31076 and LOC100331330

DIOPT Version :9

Sequence 1:NP_733184.2 Gene:CG31076 / 318582 FlyBaseID:FBgn0051076 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_017212633.1 Gene:LOC100331330 / 100331330 -ID:- Length:202 Species:Danio rerio


Alignment Length:165 Identity:50/165 - (30%)
Similarity:81/165 - (49%) Gaps:19/165 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QLILVQQNLRTLPQELVKKHADHVEQLDLSHNCLKD-LSWLADFEQLRHLVLDSNRMHEAHLRTL 73
            :|....|:|..:|.:.:.|..|.:|.||||:|.|:: .:.|...|:|..|:||.|. :.||::  
Zfish    33 RLSFAYQDLLEIPYDTILKQQDSLEVLDLSYNLLEENPALLGGLEKLSTLILDCNN-YSAHVK-- 94

  Fly    74 TCP-LPQLEVLMLNKNEFSDLPTTMRLIRKFFPNLQYLSLHGNPICPDGLELQPFSTYLRYDYEY 137
             .| :|.|..|.:|||:.|:||..:..|...|||::.||:..|...|........:.|:.     
Zfish    95 -FPFMPSLTTLWINKNKISNLPIIVEEICCKFPNIKILSMMNNEAAPSYFNGGSLTQYID----- 153

  Fly   138 YSNYIAQSLSKLKFLDHGLVQ--------RTYKYE 164
            |..|:...:..|:.||...||        :||:.:
Zfish   154 YRQYVISQILGLEVLDDTEVQEKEREQARKTYRLQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31076NP_733184.2 LRR_8 11..65 CDD:290566 20/54 (37%)
leucine-rich repeat 11..32 CDD:275378 5/20 (25%)
leucine-rich repeat 33..54 CDD:275378 8/21 (38%)
leucine-rich repeat 55..79 CDD:275378 8/24 (33%)
leucine-rich repeat 80..106 CDD:275378 10/25 (40%)
LOC100331330XP_017212633.1 LRR_8 30..88 CDD:290566 19/54 (35%)
leucine-rich repeat 31..55 CDD:275380 5/21 (24%)
leucine-rich repeat 56..78 CDD:275380 8/21 (38%)
LRR_9 <76..189 CDD:258718 36/122 (30%)
leucine-rich repeat 79..100 CDD:275380 8/24 (33%)
leucine-rich repeat 101..127 CDD:275380 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D438561at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.