DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and URA1

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_012706.1 Gene:URA1 / 853664 SGDID:S000001699 Length:314 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:73/312 - (23%)
Similarity:134/312 - (42%) Gaps:38/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 FENPFGLASAPPTTSTAMIRRAFEQGWGFVVTKT-FGLDKDLVTNVSPRIVR---GTTSGYKYGP 597
            :||||..||.....:|..:........|..:||: ..|:::  .|..||.:.   |:.:.... |
Yeast    14 YENPFMNASGVHCMTTQELDELANSKAGAFITKSATTLERE--GNPEPRYISVPLGSINSMGL-P 75

  Fly   598 QQGCFLNIELISEKRAEYWLKSIGELKRDFPEKIVIASIMCSFNEEDWTELAIKAEQSGADAL-E 661
            .:|            .:|:|..:...::::|:...|...:...:.::...|..|.:.|..:.: |
Yeast    76 NEG------------IDYYLSYVLNRQKNYPDAPAIFFSVAGMSIDENLNLLRKIQDSEFNGITE 128

  Fly   662 LNLSCPHGMGERGMGLACGQDPELVEQISRWVRKAVKLPFFIKLTPNITDIVSIAAAAKRGGADG 726
            ||||||:..|:..:........|.:|::..:.:|    |..:||.|.. |.......||......
Yeast   129 LNLSCPNVPGKPQVAYDFDLTKETLEKVFAFFKK----PLGVKLPPYF-DFAHFDIMAKILNEFP 188

  Fly   727 GSAINTVQGL-MGLKADSTAWPAIGKEQ-----RTTYGGVSGNATRPMALKAISDIANRV-PGFP 784
            .:.:|::..: .||..|      :.||.     :..:||:.|...:|.||..:.....|: |...
Yeast   189 LAYVNSINSIGNGLFID------VEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYTRLRPEIK 247

  Fly   785 ILGIGGIDSGEVALQFIHAGATVLQICSSVQNQDFTVIEDYCTALKALLYLK 836
            ::|.|||.||:.|.:.:..||::|||.:.:|.:...:.|.....||.::..|
Yeast   248 VIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967
Fer4_20 58..170 CDD:291363
NAD_binding_8 190..>234 CDD:290186
PRK08318 527..1008 CDD:236237 73/312 (23%)
DHPD_FMN 527..829 CDD:239244 70/303 (23%)
Fer4_9 953..997 CDD:289930
URA1NP_012706.1 PRK02506 4..314 CDD:235045 73/312 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1944
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100674
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.