DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and PYD1

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_188408.1 Gene:PYD1 / 821049 AraportID:AT3G17810 Length:426 Species:Arabidopsis thaliana


Alignment Length:315 Identity:124/315 - (39%)
Similarity:184/315 - (58%) Gaps:17/315 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 DISVEMCGIRFENPFGLASAPPTTSTAMIRRAFEQGWGFVVTKTFGLDKDLVTNVSPRIVR---G 588
            |:||.:.|::..|||.:.|.||.|:..:::|||::|||.|:.||..||...|.||:||..|   |
plant    51 DLSVTVNGLKMPNPFVIGSGPPGTNYTVMKRAFDEGWGAVIAKTVSLDASKVINVTPRYARLRTG 115

  Fly   589 TTSGYK---YGPQQGCFLNIELISEKRAEYWLKSIGELKRDFPEKIVIASIMCSFNEEDWTELAI 650
            :....|   .|.|     ||||||::..|..||....||:::|::|:|||:|..:|:..|.||..
plant   116 SNGSAKTDVIGWQ-----NIELISDRPLETMLKEFERLKKEYPDRILIASVMEEYNKTAWEELID 175

  Fly   651 KAEQSGADALELNLSCPHGMGERGMGLACGQDPELVEQISRWVRKAVKLPFFIKLTPNITDIVSI 715
            :.||:|.||||:|.||||||.||.||.|.|||..|::::..|:.....:|.:.|:|||||||...
plant   176 RVEQTGVDALEINFSCPHGMPERRMGAAVGQDCALLDEVCGWINAKATVPVWAKMTPNITDITEP 240

  Fly   716 AAAAKRGGADGGSAINTVQGLMGLKADSTAWPAIGKEQRTTYGGVSGNATRPMALKAISDIANRV 780
            |..:.:.|.:|.:||||:..:||:.. .|..|....|..:|.||.|..|.||:||..:.:||..:
plant   241 ARVSLKSGCEGIAAINTIMSVMGIDM-KTLRPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAKMM 304

  Fly   781 PG-----FPILGIGGIDSGEVALQFIHAGATVLQICSSVQNQDFTVIEDYCTALK 830
            ..     ..:.||||:::|..|.:||..|:..:|:|:.|....:..::..|..||
plant   305 KSEFSEDRSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967
Fer4_20 58..170 CDD:291363
NAD_binding_8 190..>234 CDD:290186
PRK08318 527..1008 CDD:236237 124/315 (39%)
DHPD_FMN 527..829 CDD:239244 122/312 (39%)
Fer4_9 953..997 CDD:289930
PYD1NP_188408.1 PLN02495 44..426 CDD:215273 124/315 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 221 1.000 Domainoid score I712
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002090
OrthoInspector 1 1.000 - - oto3947
orthoMCL 1 0.900 - - OOG6_100674
Panther 1 1.100 - - LDO PTHR43073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1768
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.