DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and dhodh

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_001025575.1 Gene:dhodh / 594963 XenbaseID:XB-GENE-967864 Length:401 Species:Xenopus tropicalis


Alignment Length:328 Identity:81/328 - (24%)
Similarity:144/328 - (43%) Gaps:50/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 ISVEMCGIRFENPFGLASAPPTTSTAMIRRAFEQGWGFVVTKTFGLDKDLVTNVSPRIVRGTTSG 592
            :.|::.|..|.||.|||:.......| :...|:.|:|||...:. ..|....|..||:.|     
 Frog    78 LEVKVLGHTFRNPVGLAAGFDKHGEA-VDGLFKIGFGFVEVGSI-TPKPQDGNPKPRVFR----- 135

  Fly   593 YKYGPQQGCFLN--------IELISEKRAEYWLKSIGELKRDFPEKIVIASIMCSFN-------- 641
               .||.|..:|        :|::.::..|         :|:..:.:..|.:....|        
 Frog   136 ---LPQDGAVINRYGFNSHGVEVVRQRLLE---------RREKQKMLTAAGMPLGINLGKNKTSE 188

  Fly   642 --EEDWTELAIKAEQSGADALELNLSCPHGMGERGMGLACGQDPELVEQISRWVRKAVKLPFFIK 704
              ..|:|: .::...|.||.|.:|:|.|:..|.|.:.   |:|     |:.:.:.:.||....::
 Frog   189 DAAADYTQ-GLQQLGSLADYLVINVSSPNTPGLRNLQ---GRD-----QLRKLLTEVVKSRNALQ 244

  Fly   705 LTPNITDIVSIAAAAKRGGADGGSAINTVQGLMGLKADSTAW---PAIGKEQRTTYGGVSGNATR 766
            ..|....:|.||........:..:::.|..|:.||...:|..   .::...|::..||:||...|
 Frog   245 CDPKPALLVKIAPDLSMQDKEDIASVVTEVGIDGLIISNTTISRPSSLQDPQKSEVGGLSGIPLR 309

  Fly   767 PMALKAISDIANRVPG-FPILGIGGIDSGEVALQFIHAGATVLQICSSVQNQDFTVIEDYCTALK 830
            .:|.:.:.::.....| .||:|:||:.||..||..|.|||:::|:.:::..|...|:....|.|.
 Frog   310 DLATETVREMYALTAGKIPIIGVGGVFSGLDALHKIRAGASLVQLYTALTYQGPPVVGKVTTELD 374

  Fly   831 ALL 833
            .||
 Frog   375 QLL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967
Fer4_20 58..170 CDD:291363
NAD_binding_8 190..>234 CDD:290186
PRK08318 527..1008 CDD:236237 81/328 (25%)
DHPD_FMN 527..829 CDD:239244 78/322 (24%)
Fer4_9 953..997 CDD:289930
dhodhNP_001025575.1 DHOD_2_like 43..373 CDD:240089 78/322 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.