DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and Dhod

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_477224.1 Gene:Dhod / 41022 FlyBaseID:FBgn0000447 Length:405 Species:Drosophila melanogaster


Alignment Length:337 Identity:83/337 - (24%)
Similarity:144/337 - (42%) Gaps:62/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 DAVDISVEMCGIRFENPFGLASAPPTTSTAMIRRAFEQGWGFVVTKTFGLDKDLVT------NVS 582
            |..::.....|....||.|:|:.....:.| :....:.|:||:...|       ||      |..
  Fly    82 DDQNLHTSFFGRMLSNPIGIAAGFDKNAEA-VDGLQDLGFGFIEVGT-------VTPAAQEGNPK 138

  Fly   583 PRIVRGTTS-------GYKYGPQQGCFLNIELISEKRAEYWLKSIG-ELKRDFPEKIVIASIMCS 639
            ||:.|.|..       |:.....|.....:.|:.:|  |.:...:| .|.|:   |..::.|   
  Fly   139 PRVFRLTEDKAIINRYGFNSDGHQAVLQRLRLLRKK--ENFNGVVGVNLGRN---KTTMSPI--- 195

  Fly   640 FNEEDWTELAIKAEQSGADALELNLSCPHGMGERGMGLACGQDP----ELVEQIS---RWVRKAV 697
               .|:.: .::.....||.|.:|:|.|:..|.|.|     |..    ||:||::   ..:.|..
  Fly   196 ---ADYVQ-GVRVFGPVADYLVINVSSPNTKGLRDM-----QSKEKLRELLEQVNDTKSSLDKNK 251

  Fly   698 KLPFFIKLTPNIT-----DIVSIAAAAKRGGADGGSAINTVQGLMGLKADSTAWPAIGKEQRTTY 757
            .:|..:||:|:::     |||.: ...|:...||....||......::.:..|       :.|  
  Fly   252 NVPILLKLSPDLSLDDMKDIVWV-IKRKKSRVDGLIVSNTTVSRENIEKNKLA-------EET-- 306

  Fly   758 GGVSGNATRPMALKAISDIANRVPG-FPILGIGGIDSGEVALQFIHAGATVLQICSSVQNQDFTV 821
            ||:||...:..:.:.|:.:.....| .||:|:||:.||..|.:.|.|||:.:||.:::..:...:
  Fly   307 GGLSGPPLKARSTEMIAQMYQLTDGKIPIIGVGGVASGYDAYEKIEAGASYVQIYTALVYEGPAL 371

  Fly   822 IEDYCTALKALL 833
            :||....|.||:
  Fly   372 VEDIKAELSALI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967
Fer4_20 58..170 CDD:291363
NAD_binding_8 190..>234 CDD:290186
PRK08318 527..1008 CDD:236237 82/334 (25%)
DHPD_FMN 527..829 CDD:239244 79/328 (24%)
Fer4_9 953..997 CDD:289930
DhodNP_477224.1 PRK05286 45..387 CDD:235388 83/337 (25%)
DHOD_2_like 51..379 CDD:240089 80/331 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.