DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and CG9674

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_001246804.1 Gene:CG9674 / 39878 FlyBaseID:FBgn0036663 Length:2115 Species:Drosophila melanogaster


Alignment Length:523 Identity:129/523 - (24%)
Similarity:210/523 - (40%) Gaps:77/523 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKTQCSVVPTKQTKENKKHWKRNADHAAPPCTTLANDFSDIKHTTLSERGALEEAARCLKCADAP 88
            ||.:....|.:...|.:|.|               ::..:..|.   .:....:||||::|....
  Fly  1628 VKYKRESAPYRDAGERQKDW---------------DEVYNFPHV---RKNLKVQAARCMECGVPF 1674

  Fly    89 CQKS---CPTQLDIKSFITSIANKNFYGAAKAIFSDNPLGLTCGMVCPTSDLCVGGCNLQASEAG 150
            ||.:   ||....|..:...:.:..:..|.:.:...|......|.|||..  |.|.|.|..||..
  Fly  1675 CQSNSTGCPLGNIIPKWNDLVFHGEWQEALRQLLQTNNFPEFTGRVCPAP--CEGSCVLGISEPA 1737

  Fly   151 PINIGGLQQFATEVFKKMGVRQRRTPQAEANPLSQKIALVGGGPASLSCATFLARLGYRDVTIYE 215
             :.|..::....:...:.|..:...|:...   .:::|:||.||:.|:.:..|.|.|: .||::|
  Fly  1738 -VTIKNIECAIIDHAFEQGWIKPEIPEVRT---GKRVAIVGSGPSGLAASQQLNRAGH-FVTVFE 1797

  Fly   216 RRSYLGGLSAAEIPQYRLPIDAVNFEIDLVRDLGVRIETGRSLGTKDLTIQGLLSTGHDAVFVGI 280
            |...:|||....||..:|..:.|...:||:.|.|:...|...:| |||..:.||.. :|||.:..
  Fly  1798 RNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVG-KDLKAEQLLQE-YDAVLLTT 1860

  Fly   281 GLPEPKLNPIFAGLQPSNGFYTSKNFLPLVSDGSKPGLCACKAAAGLPKLHGNVIVLGAGDTAFD 345
            |...|:..|:  ..:...|.:.:..||.........|.....:|||     .|||::|.|||..|
  Fly  1861 GSTWPRDLPL--ANRDLKGIHFAMEFLEAQQKKQLGGKNDIISAAG-----KNVIIIGGGDTGCD 1918

  Fly   346 CATSALRCGARRVFV----------------------VFRKGSSGIRAVPEEVEL--ARDERCEL 386
            |..::||.||:.:..                      |||     :....|||:|  .:|.|   
  Fly  1919 CIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFR-----VDYGHEEVKLKWGKDPR--- 1975

  Fly   387 LPYLSPRKVIV-KDGLITAMEFCRTE--QNENDEWVEDE--EQTQRLKANFVISAFGSGLEDQDV 446
             .|.:..|..| ::|.|..:.....|  :.|..:|...|  ...:...|:.::.|.|....::.|
  Fly  1976 -QYCTTTKEFVGENGAIKGVNTVEVEWTKTETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTV 2039

  Fly   447 KAALA-PLQFRGELPVVDRVTMQSSVKQVFLGGDLAGVANTTVESVNDGKVAAWSIHCQLQGLPL 510
            .:.|. .|..||.:...:.....|:.| ||..||.....:..|.::.:|:.||..:...|.|.|.
  Fly  2040 PSELGLELDPRGNIKASNGQYGTSNSK-VFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPS 2103

  Fly   511 DTP 513
            ..|
  Fly  2104 GLP 2106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967 120/484 (25%)
Fer4_20 58..170 CDD:291363 24/114 (21%)
NAD_binding_8 190..>234 CDD:290186 17/43 (40%)
PRK08318 527..1008 CDD:236237
DHPD_FMN 527..829 CDD:239244
Fer4_9 953..997 CDD:289930
CG9674NP_001246804.1 gltB 75..1565 CDD:236968
GATase_2 88..504 CDD:278726
Glu_syn_central 543..828 CDD:282720
GltS_FMN 918..1271 CDD:239202
gltB_C 1316..1565 CDD:238482
gltD 1623..2106 CDD:237213 128/521 (25%)
Fer4_8 1645..1756 CDD:302761 26/131 (20%)
NAD_binding_8 1772..>1804 CDD:290186 12/32 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.