DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment su(r) and dare

DIOPT Version :9

Sequence 1:NP_727320.1 Gene:su(r) / 31858 FlyBaseID:FBgn0086450 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_477150.1 Gene:dare / 36203 FlyBaseID:FBgn0015582 Length:466 Species:Drosophila melanogaster


Alignment Length:479 Identity:103/479 - (21%)
Similarity:164/479 - (34%) Gaps:144/479 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KMGVRQRRTPQAEANPLSQKIALVGGGPASLSCA-TFLARLGYRDVTIYERRSYLGGL----SAA 226
            ::.|.|..||       :::|.:||.|||....| ..|.:|....|.:.|:.....||    .|.
  Fly    19 RLQVIQSTTP-------TKRICIVGAGPAGFYAAQLILKQLDNCVVDVVEKLPVPFGLVRFGVAP 76

  Fly   227 EIPQYRLPIDAVNFEIDLVRDLGVRIETGRSLGTKDLTIQGLLSTGHDAVFVGIG--------LP 283
            :.|:.:   :.:|..........:|.....|||| |::::.|....| ||.:..|        |.
  Fly    77 DHPEVK---NVINTFTKTAEHPRLRYFGNISLGT-DVSLRELRDRYH-AVLLTYGADQDRQLELE 136

  Fly   284 EPKLNPIFAGLQPSNGFYTSKNFLPLVSDGSKPGLCACKAAAGL-PKLHG-NVIVLGAGDTAFDC 346
            ..:|:.:.:    :..|....|.||              .|..| |.|.| :|.::|.|:.|.|.
  Fly   137 NEQLDNVIS----ARKFVAWYNGLP--------------GAENLAPDLSGRDVTIVGQGNVAVDV 183

  Fly   347 -------------------ATSALRCG-ARRVFVVFRKGS------------------------- 366
                               |..||.|. ..||.:|.|:|.                         
  Fly   184 ARMLLSPLDALKTTDTTEYALEALSCSQVERVHLVGRRGPLQAAFTIKELREMLKLPNVDTRWRT 248

  Fly   367 ---SGIRAVPEEVELARDERCELLPYLSPRKVIVKDGLITA-------------------MEFCR 409
               |||....::::..|....||:     .|.:.:.|.|:.                   |||..
  Fly   249 EDFSGIDMQLDKLQRPRKRLTELM-----LKSLKEQGRISGSKQFLPIFLRAPKAIAPGEMEFSV 308

  Fly   410 TEQNENDEWVEDEEQTQRLKANFVISAFG--SGLEDQDVKAALAPLQFRGELPVVD-RVTMQSSV 471
            ||..:  |.......|:||.::.::.:.|  |...|..:.....    ||.:..:: |:....:.
  Fly   309 TELQQ--EAAVPTSSTERLPSHLILRSIGYKSSCVDTGINFDTR----RGRVHNINGRILKDDAT 367

  Fly   472 KQV--------FLGGDLAGVANTTVESVNDGKVAAWSIHCQLQGLPLDTPAALPLFYTDIDAVDI 528
            .:|        :||....||..||   :|.....|.:|...:....|||.:..|.:..|...|  
  Fly   368 GEVDPGLYVAGWLGTGPTGVIVTT---MNGAFAVAKTICDDINTNALDTSSVKPGYDADGKRV-- 427

  Fly   529 SVEMCGIR----FENPFGLASAPP 548
             |...|.:    ||:..|.|...|
  Fly   428 -VTWDGWQRINDFESAAGKAKGKP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
su(r)NP_727320.1 PRK11749 55..507 CDD:236967 90/432 (21%)
Fer4_20 58..170 CDD:291363 0/2 (0%)
NAD_binding_8 190..>234 CDD:290186 14/48 (29%)
PRK08318 527..1008 CDD:236237 7/26 (27%)
DHPD_FMN 527..829 CDD:239244 7/26 (27%)
Fer4_9 953..997 CDD:289930
dareNP_477150.1 PLN02852 10..465 CDD:215457 103/479 (22%)
NAD_binding_8 34..98 CDD:290186 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.