DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and DMC1

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_011106.1 Gene:DMC1 / 856926 SGDID:S000000981 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:57/185 - (30%)
Similarity:81/185 - (43%) Gaps:15/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DISQSASNKILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSA 101
            ||.|...: :.||.|.||:..||||....:.|:.|....|||||...||:..|:|:..||.||..
Yeast    88 DIRQRVYS-LSTGSKQLDSILGGGIMTMSITEVFGEFRCGKTQMSHTLCVTTQLPREMGGGEGKV 151

  Fly   102 LFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVD 166
            .:|||...|.|:|:..:|...|..     ||    ..|..:.|.|....:..|..|......| .
Yeast   152 AYIDTEGTFRPERIKQIAEGYELD-----PE----SCLANVSYARALNSEHQMELVEQLGEEL-S 206

  Fly   167 HPDIKLIVIDSLAFTLRMLEDG----AHRYEMLLELHESMRRLQRQHELTWVFTN 217
            ..|.:|||:||:....|:...|    :.|.:.|.:....:.||..:..:....||
Yeast   207 SGDYRLIVVDSIMANFRVDYCGRGELSERQQKLNQHLFKLNRLAEEFNVAVFLTN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 54/176 (31%)
DMC1NP_011106.1 recomb_DMC1 19..332 CDD:131292 57/185 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.