DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_011021.3 Gene:RAD51 / 856831 SGDID:S000000897 Length:400 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:67/214 - (31%)
Similarity:98/214 - (45%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDF 110
            :.||.|.|||..|||:..|.:.||.|...|||:|:|..|.:..|||...||.||..|:|||...|
Yeast   160 LTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTF 224

  Fly   111 HPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVI 175
            .|.||:.:|.:....     |:    ..|..:.|.|....|..: .:|.....::......|||:
Yeast   225 RPVRLVSIAQRFGLD-----PD----DALNNVAYARAYNADHQL-RLLDAAAQMMSESRFSLIVV 279

  Fly   176 DSLAFTLRMLEDGAHRYEM---LLELHESMRRLQRQHELTWVFTNVLTHRYVKQ-----KFQVEP 232
            ||:....|  .|.:.|.|:   .:.|.:.||.|||..:...|.. |:|::.|.|     .|..:|
Yeast   280 DSVMALYR--TDFSGRGELSARQMHLAKFMRALQRLADQFGVAV-VVTNQVVAQVDGGMAFNPDP 341

  Fly   233 AL---GDLHSHLINERIWF 248
            ..   |::.:|....|:.|
Yeast   342 KKPIGGNIMAHSSTTRLGF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 67/214 (31%)
RAD51NP_011021.3 recomb_RAD51 83..397 CDD:274048 67/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.