DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD57

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_010287.1 Gene:RAD57 / 851567 SGDID:S000002411 Length:460 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:65/232 - (28%)
Similarity:99/232 - (42%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVWEPSQPEAIERRPSVSHENFRIFDKSCWDISQSASNK---ILTGKKALDTHFGGGISLGHLVE 68
            |:.:.|..|....:..:.||....:.:.|...|.|..|.   ..|...|:|...||||....:.|
Yeast    58 RLIQRSINEVFRFQQLLVHEYNEKYLEICEKNSISPDNGPECFTTADVAMDELLGGGIFTHGITE 122

  Fly    69 LIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEF 133
            :.|.|.|||:|:.:||.|:||:.:.||||.|..::|.|..|....|       ||...:.| |.:
Yeast   123 IFGESSTGKSQLLMQLALSVQLSEPAGGLGGKCVYITTEGDLPTQR-------LESMLSSR-PAY 179

  Fly   134 KAHKMLQ-KIHYVRCPKLDQLMATVLSCHRHLVD----------HPDIKLIVIDSLAFTLRM-LE 186
            :...:.| .|..|.|..|..        ..|:::          ...|||::|||::..||: |:
Yeast   180 EKLGITQSNIFTVSCNDLIN--------QEHIINVQLPILLERSKGSIKLVIIDSISHHLRVELQ 236

  Fly   187 DGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRY 223
            :.:.|     |..|:...|.|..|.    ..:|.|.|
Yeast   237 NKSFR-----ESQENKNYLDRMAEK----LQILAHDY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 56/190 (29%)
RAD57NP_010287.1 XRCC3 107..445 CDD:410899 54/183 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.