DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD51B

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_180423.3 Gene:RAD51B / 817404 AraportID:AT2G28560 Length:371 Species:Arabidopsis thaliana


Alignment Length:269 Identity:70/269 - (26%)
Similarity:110/269 - (40%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISQSASNKILTGK-----KALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGL 97
            :.:...|:.|:|.     |.||....|||..|.|.||:|..|.||:|.|::|.|:...|.|.|||
plant    71 LEKKVENEHLSGHLPTHLKGLDDTLCGGIPFGVLTELVGPPGIGKSQFCMKLALSASFPVAYGGL 135

  Fly    98 EGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHR 162
            :|..::||....|...|::.:.|:...:..|.  :..|.:|..:|..:|...|.....::.....
plant   136 DGRVIYIDVESKFSSRRVIEMGLESFPEVFHL--KGMAQEMAGRILVLRPTSLANFTESIQELKN 198

  Fly   163 HLVDHPDIKLIVIDSLAFTLRMLEDGAHRYEMLLELHESMRRLQRQHELTW-------------- 213
            .::.: .:||:||||:...|.               .|:....|||.:|.|              
plant   199 SILQN-QVKLLVIDSMTALLS---------------GENKPGAQRQPQLGWHISFLKSLAEFSRI 247

  Fly   214 --VFTNVL-------THRY-----VKQKFQVEPALGDLHSHLINERIWFSGSSELHLGKSWR--- 261
              |.||.:       |.:|     ||.:|:......|  |||:           ..||.:|.   
plant   248 PIVVTNQVRSQNRDETSQYSFQAKVKDEFKDNTKTYD--SHLV-----------AALGINWAHAV 299

  Fly   262 TSRLIKESE 270
            |.||:.|::
plant   300 TIRLVLEAK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 62/235 (26%)
RAD51BNP_180423.3 Rad51 65..336 CDD:285604 70/269 (26%)
P-loop_NTPase 84..337 CDD:304359 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.