DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD51B

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001308750.1 Gene:RAD51B / 5890 HGNCID:9822 Length:425 Species:Homo sapiens


Alignment Length:267 Identity:71/267 - (26%)
Similarity:112/267 - (41%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HENFRIFDKSCWDISQSA-----------SNKIL-TGKKALDTHFGGGISLGHLVELIGNSGTGK 77
            ||...:..::|....|:|           |...| |...|||....||::.|.|.|:.|..|.||
Human    50 HELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGK 114

  Fly    78 TQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEF--KAHKML- 139
            ||.|:.:.:...:|...|||||:.::|||...|..:||:.:|       ..|.|.:  ...|:| 
Human   115 TQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIA-------ESRFPRYFNTEEKLLL 172

  Fly   140 --QKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRMLEDG------AHRYEMLL 196
              .|:|..|....|:::..:.|....::. ..|||:::||:|..:|...|.      ..|.:.|.
Human   173 TSSKVHLYRELTCDEVLQRIESLEEEIIS-KGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLA 236

  Fly   197 ELHESMRRLQRQHELTWVFTN-VLTH---RYVKQKFQVEP------------------ALGDLHS 239
            ....|::.|..:..:..:.|| :.||   ....|...|.|                  |||:..|
Human   237 REASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWS 301

  Fly   240 HLINERI 246
            |.:|.|:
Human   302 HSVNTRL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 65/235 (28%)
RAD51BNP_001308750.1 Rad51 65..342 CDD:285604 68/252 (27%)
Rad51_DMC1_radA 83..343 CDD:238543 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.