DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD51C

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006722064.1 Gene:RAD51C / 5889 HGNCID:9820 Length:377 Species:Homo sapiens


Alignment Length:256 Identity:82/256 - (32%)
Similarity:125/256 - (48%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EAIERRP-----SVSHENFRIFDKSCWDI----SQSASNKILTGKKALDTHFGGGISLGHLVELI 70
            |.:..:|     |.||       |.|..:    .:.....|:|...|||...|||:.|....|:.
Human    67 ECLTNKPRYAGTSESH-------KKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEIC 124

  Fly    71 GNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLA------LKL----ERQ 125
            |..|.||||:|:||.::||||:..||:.|.|:||||...|..||::.||      |:|    .:.
Human   125 GAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKG 189

  Fly   126 YAHR--VPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRM-LED 187
            ..||  :.:|....:|..|:|.||....:|:|.|......|.:|..::|:::|.:||..|. |:|
Human   190 EEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDD 254

  Fly   188 GAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINERIWF 248
            .:.|..:|..|.:.|..|...|.|..:.||.:|.:..:.:..:.||||:...|....|:.|
Human   255 LSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 75/216 (35%)
RAD51CXP_006722064.1 HHH_5 12..57 CDD:291205
recomb_radA 21..349 CDD:131290 82/256 (32%)
Rad51_DMC1_radA 100..348 CDD:238543 75/216 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157044
Domainoid 1 1.000 117 1.000 Domainoid score I5907
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4796
Isobase 1 0.950 - 1 Normalized mean entropy S3735
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 1 1.000 - - FOG0006918
OrthoInspector 1 1.000 - - oto88446
orthoMCL 1 0.900 - - OOG6_104543
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.610

Return to query results.
Submit another query.