DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and RAD51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001157741.1 Gene:RAD51 / 5888 HGNCID:9817 Length:340 Species:Homo sapiens


Alignment Length:297 Identity:72/297 - (24%)
Similarity:119/297 - (40%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EAIERRPSVSHENFRIFDKSCWDISQSASNKILTGKKAL---------------------DTHFG 58
            ||:...|.....|.:       .||::.::||||..:::                     |:...
Human    50 EAVAYAPKKELINIK-------GISEAKADKILTESRSVARLECNSVILVYCTLRLSGSSDSPAS 107

  Fly    59 --------GGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRL 115
                    |||..|.:.|:.|...|||||:|..|.:..|:|...||.||.|::|||...|.|:||
Human   108 ASRVVGTTGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERL 172

  Fly   116 MGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAF 180
            :.:|    .:|.     .....:|..:.|.|....|.....:......:|: ....|:::||...
Human   173 LAVA----ERYG-----LSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVE-SRYALLIVDSATA 227

  Fly   181 TLRMLEDGAHRYEM---LLELHESMRRLQRQHELTWVFTNVLTHRYVKQ-----KFQVEPAL--- 234
            ..|  .|.:.|.|:   .:.|...:|.|.|..:...|.. |:|::.|.|     .|..:|..   
Human   228 LYR--TDYSGRGELSARQMHLARFLRMLLRLADEFGVAV-VITNQVVAQVDGAAMFAADPKKPIG 289

  Fly   235 GDLHSHLINERIWF-SGSSELHLGKSWRTSRLIKESE 270
            |::.:|....|::. .|..|..:.|.: .|..:.|:|
Human   290 GNIIAHASTTRLYLRKGRGETRICKIY-DSPCLPEAE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 59/243 (24%)
RAD51NP_001157741.1 recomb_RAD51 25..340 CDD:274048 72/297 (24%)
HHH_5 32..77 CDD:291205 9/33 (27%)
Rad51_DMC1_radA 116..336 CDD:238543 61/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.