DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016393.1 Gene:rad51 / 549147 XenbaseID:XB-GENE-1016881 Length:336 Species:Xenopus tropicalis


Alignment Length:244 Identity:69/244 - (28%)
Similarity:110/244 - (45%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109
            :|.||.|.||....|||..|.:.|:.|...|||||:|..|.:..|:|...||.||.|::|||...
 Frog    98 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDRGGGEGKAMYIDTEGT 162

  Fly   110 FHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLD---QLM---ATVLSCHRHLVDHP 168
            |.|:||:.:|    .:|.     .....:|..:.|.|....|   ||:   :.:::..|:     
 Frog   163 FRPERLLAVA----ERYG-----LSGSDVLDNVAYARAFNTDHQTQLLYQASAMMAESRY----- 213

  Fly   169 DIKLIVIDSLAFTLRMLEDGAHRYEM---LLELHESMRRLQRQHELTWVFTNVLTHRYVKQ---- 226
              .|:::||.....|  .|.:.|.|:   .:.|...:|.|.|..:...|.. |:|::.|.|    
 Frog   214 --ALLIVDSATALYR--TDYSGRGELSARQMHLARFLRMLLRLADEFGVAV-VITNQVVAQVDGA 273

  Fly   227 -KFQVEPAL---GDLHSHLINERIWF-SGSSELHLGKSWRTSRLIKESE 270
             .|..:|..   |::.:|....|::. .|..|..:.|.: .|..:.|:|
 Frog   274 AMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIY-DSPCLPEAE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 63/220 (29%)
rad51NP_001016393.1 recomb_RAD51 22..336 CDD:274048 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.