DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and xrcc3

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016141.1 Gene:xrcc3 / 548895 XenbaseID:XB-GENE-1016741 Length:348 Species:Xenopus tropicalis


Alignment Length:246 Identity:72/246 - (29%)
Similarity:105/246 - (42%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109
            |:..|.|.||....||:.|..:.|:.|.|..||||:.|||||:||.|...|||...|::|.|...
 Frog    81 KLSLGCKVLDNFLRGGVPLVGITEIAGESSAGKTQIGLQLCLSVQYPVEYGGLASGAVYICTEDA 145

  Fly   110 FHPDRLMGLALKLERQYAHRVPE--FKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKL 172
            |...||..| :|.:.:....||.  .|..:....|.......:|.|...:......|:....|:|
 Frog   146 FPSKRLQQL-IKSQHKLRSDVPTEVIKNIRFGDSIFVEHTADVDTLTECITKKVPVLLLRGSIRL 209

  Fly   173 IVIDSLAFTLR---MLEDGA----HRYEMLLELHESMRRLQRQHELTWVF-TNVLTHRYVK---- 225
            ::|||:|...|   ..:|.|    |...:..:||....|.     ||.|. .|.:|.|..:    
 Frog   210 VIIDSIAALFRCEFAAKDAAIKAKHLQTLGAKLHSMSNRF-----LTPVLCINQVTDRVREMNSE 269

  Fly   226 ------QKFQVEPALGDLHSHLINERIWFSGSSEL----HLGKSWRTSRLI 266
                  |..:|.||||...|:.:..|:..:.:..:    |.|...||..::
 Frog   270 QIDLGLQDKKVVPALGISWSNQLLMRVMVARTQHMAPAEHAGGILRTMEVV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 67/222 (30%)
xrcc3NP_001016141.1 RNA_pol_A_CTD <4..64 CDD:332122
Rad51_DMC1_radA 82..340 CDD:238543 71/245 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.