DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51c

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016923.1 Gene:rad51c / 548416 XenbaseID:XB-GENE-1015191 Length:361 Species:Xenopus tropicalis


Alignment Length:272 Identity:82/272 - (30%)
Similarity:132/272 - (48%) Gaps:24/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQPEAIE-----RRPSVSHENFRIFDK-SCWDI--SQSASNKILTGKKALDTHFGGGISLGHLVE 68
            |..||:|     :..:.|..:.:|..| :.:|:  .:.:...::|...|||...||||.:..:.|
 Frog    44 SNEEALEVLQIVKGEAQSSSSCQIIQKHTAFDLLGQEQSQGFVITFCSALDEILGGGIPVAKITE 108

  Fly    69 LIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKL----------- 122
            :.|..|.||||:|:||.::||||:..||:.|..:||||...|..:|||.:|...           
 Frog   109 ICGVPGVGKTQLCMQLAVDVQIPECFGGVAGETVFIDTECSFRLERLMDIANACVQHCNLIAQGH 173

  Fly   123 -ERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLR-ML 185
             ::.:...:..|..:::|.:|:|..|....:|:|.:......|..||.:||:||||:||..| ..
 Frog   174 QDKDHIKAMQTFTLNEILSQIYYFSCHDYIELLAQINLLPDFLSSHPKVKLVVIDSIAFPFRHSF 238

  Fly   186 EDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINERI---W 247
            ||.:.|..:|....:.:..|.....|..|.||.:|.:......::.||||:...|....|:   |
 Frog   239 EDLSLRTRLLNGFGQQLISLAHNCNLAVVLTNQMTTKIGPSDSKLVPALGESWGHASTIRLILHW 303

  Fly   248 FSGSSELHLGKS 259
            .|....:.|.||
 Frog   304 KSKQRFVTLCKS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 70/218 (32%)
rad51cNP_001016923.1 Rad51_DMC1_radA 86..333 CDD:238543 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6098
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 1 1.000 - - FOG0006918
OrthoInspector 1 1.000 - - oto102326
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 1 1.000 - - X4389
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.