DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and xrcc3

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001013559.1 Gene:xrcc3 / 541414 ZFINID:ZDB-GENE-050320-116 Length:352 Species:Danio rerio


Alignment Length:207 Identity:61/207 - (29%)
Similarity:85/207 - (41%) Gaps:34/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMG 117
            ||....||:.|..:.||.|.|..||||.||||||:||.|:..|||...|::|.|...|...||  
Zfish    89 LDGLMRGGLPLRGITELAGESAAGKTQFCLQLCLSVQYPQEHGGLNSGAVYICTEDSFPIKRL-- 151

  Fly   118 LALKLERQYAHRVPEFKAHKMLQKIHYVR---------CPKLDQLMATVLSCHRHLVDHPDIKLI 173
                  ||...:.|..:.......||.:|         ...|:.|...|......|:....::|:
Zfish   152 ------RQLITQQPRLRPDLPPALIHSLRFSDNIYIEHAADLEALQVCVSQRVPVLLKRGLVRLL 210

  Fly   174 VIDSLAFTLR---MLEDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLT------------HRY 223
            |:||:|...|   ..::...|...||....::.||...:....:..|.:|            :..
Zfish   211 VVDSVAALFRSEFQADEAVQRSRHLLAFSSTLHRLSHTYAAPVLCVNQVTDVVDGPNPGRCDYGL 275

  Fly   224 VKQKFQVEPALG 235
            |..|  |.||||
Zfish   276 VGSK--VLPALG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 61/207 (29%)
xrcc3NP_001013559.1 Rad51 81..339 CDD:285604 61/207 (29%)
Rad51_DMC1_radA 82..340 CDD:238543 61/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.