DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Rad51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001102674.1 Gene:Rad51 / 499870 RGDID:1563603 Length:339 Species:Rattus norvegicus


Alignment Length:238 Identity:67/238 - (28%)
Similarity:105/238 - (44%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109
            :|.||.|.||....|||..|.:.|:.|...|||||:|..|.:..|:|...||.||.|::|||...
  Rat   101 QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGT 165

  Fly   110 FHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIV 174
            |.|:||:.:|    .:|.     .....:|..:.|.|....|.....:......:|: ....|::
  Rat   166 FRPERLLAVA----ERYG-----LSGSDVLDNVAYARGFNTDHQTQLLYQASAMMVE-SRYALLI 220

  Fly   175 IDSLAFTLRMLEDGAHRYEM---LLELHESMRRLQRQHELTWVFTNVLTHRYVKQ-----KFQVE 231
            :||.....|  .|.:.|.|:   .:.|...:|.|.|..:...|.. |:|::.|.|     .|..:
  Rat   221 VDSATALYR--TDYSGRGELSARQMHLARFLRMLLRLADEFGVAV-VITNQVVAQVDGAAMFAAD 282

  Fly   232 PAL---GDLHSHLINERIWF-SGSSELHLGKSWRTSRLIKESE 270
            |..   |::.:|....|::. .|..|..:.|.: .|..:.|:|
  Rat   283 PKKPIGGNIIAHASTTRLYLRKGRGETRICKIY-DSPCLPEAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 61/214 (29%)
Rad51NP_001102674.1 recomb_RAD51 25..339 CDD:274048 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.