DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Rad51c

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038942551.1 Gene:Rad51c / 497976 RGDID:1563765 Length:402 Species:Rattus norvegicus


Alignment Length:282 Identity:89/282 - (31%)
Similarity:136/282 - (48%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQPEAIE-----RRPSVSHE----NFRIFDKSCWDI----SQSASNKILTGKKALDTHFGGGISL 63
            |:.||:|     ||..::::    ...:.:|.|..:    .:.....|:|...|||...||||.|
  Rat    80 SKEEALETLQILRRECLTNKPRCAGTSVANKKCTALELLEQEHTQGFIITFCSALDNILGGGIPL 144

  Fly    64 GHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLA------LKL 122
            ....|:.|..|.||||:|:||.::||||:..||:.|.|:||||...|..||::.||      |.|
  Rat   145 MKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVSLATACIQHLHL 209

  Fly   123 ------ERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFT 181
                  |.:....:.:|....:|..|:|.||....:|:|.|......|.||..::|::||.:||.
  Rat   210 IAGTHTEEEQQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLSDHSKVQLVIIDGIAFP 274

  Fly   182 LRM-LEDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINER 245
            .|. |:|...|..:|..|.:.:..|..:|.|..:.||.:|.:..|.:..:.||||:...|....|
  Rat   275 FRHDLDDLFLRTRLLNGLAQQLISLANKHRLAVILTNQMTTKIDKNQASLVPALGESWGHAATIR 339

  Fly   246 IWFSGSSELHLGKSWRTSRLIK 267
            :.|      |..:..|.:.|.|
  Rat   340 LIF------HWEQKQRFATLYK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 76/215 (35%)
Rad51cXP_038942551.1 Sms 97..>166 CDD:223993 21/68 (31%)
Rad51C 145..357 CDD:410900 71/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351003
Domainoid 1 1.000 122 1.000 Domainoid score I5541
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4659
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 1 1.000 - - FOG0006918
OrthoInspector 1 1.000 - - oto95586
orthoMCL 1 0.900 - - OOG6_104543
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4389
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.660

Return to query results.
Submit another query.