DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51c

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001006101.1 Gene:rad51c / 450081 ZFINID:ZDB-GENE-041010-204 Length:362 Species:Danio rerio


Alignment Length:227 Identity:75/227 - (33%)
Similarity:116/227 - (51%) Gaps:10/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDF 110
            |:|....||...|||:.:|...|:.|..|.||||:|:||.::||||...|||.|.||:|||...|
Zfish    86 IVTFCSGLDDAIGGGVPVGKTTEICGAPGVGKTQLCMQLAVDVQIPVFFGGLGGKALYIDTEGSF 150

  Fly   111 HPDRLMGLA---------LKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVD 166
            ...|:..:|         |..:.:....:.|....|:|..:..|||....:|:|.|......|.:
Zfish   151 LVQRVADMAEAAVQHCTLLAEDTEQKGALEELNVEKILSNLFLVRCHDYVKLLAEVYLLPDFLSE 215

  Fly   167 HPDIKLIVIDSLAFTLRM-LEDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQV 230
            ||:::|:||||:||..|. .||.:.|..:|..|.:.:.:|..||.:..|.||.:|.|....:.::
Zfish   216 HPEVRLVVIDSIAFPFRHDFEDLSQRTRLLNGLAQQLIQLATQHRVAVVLTNQMTTRVSNGQSKL 280

  Fly   231 EPALGDLHSHLINERIWFSGSSELHLGKSWRT 262
            .||||:...|...:|:......:..|...:::
Zfish   281 VPALGESWGHAATQRLILHWEGQRRLASLYKS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 74/212 (35%)
rad51cNP_001006101.1 radA 3..331 CDD:235273 75/227 (33%)
Rad51_DMC1_radA 86..330 CDD:238543 75/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592720
Domainoid 1 1.000 124 1.000 Domainoid score I5479
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4696
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 1 1.000 - - FOG0006918
OrthoInspector 1 1.000 - - oto39814
orthoMCL 1 0.900 - - OOG6_104543
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 1 1.000 - - X4389
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.