DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51d

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001005687.1 Gene:rad51d / 448189 XenbaseID:XB-GENE-1014974 Length:320 Species:Xenopus tropicalis


Alignment Length:270 Identity:65/270 - (24%)
Similarity:116/270 - (42%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQPEAIERRPSVSHE-----------NFRIFDKSCWDISQ--SASNKIL-TGKKALDTHFGGGIS 62
            |..|.:.|:.|:|::           .:..|..|..|:.:  .:|..|| ||.:.||.....|:.
 Frog    34 SDLEELARKCSLSYKTLMAVRRVLLAQYSAFPSSGADVYEELKSSTAILPTGNRKLDILLDSGLY 98

  Fly    63 LGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYA 127
            .|.:.|:.|.:|:||||.|..:.:||     |..|:.:.|::||.......||:.|.....:...
 Frog    99 TGEVTEIAGAAGSGKTQTCQSIAVNV-----AYNLKQTVLYVDTTGGLTASRLLQLVQSRTKSED 158

  Fly   128 HRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDH------PDIKLIVIDSLAFTLRMLE 186
            .:|..      ||:|..:|...:.:|....... ||.:..      ..::|:::||:...:..:.
 Frog   159 EQVAS------LQRIEVIRVFDIYKLFDAFQDL-RHQISQQLLRSGEPLRLVIVDSVCAVIYPML 216

  Fly   187 DGAHRYEM--LLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINERIWFS 249
            .|.|...|  :::|...::.|...:.|..:.:|.:|.......   .||||...|.:.:.||..:
 Frog   217 GGKHTEGMAIMMQLARELQTLAHDYHLAILISNSITKDGATGN---RPALGRSWSFVPSTRILLT 278

  Fly   250 GSSELHLGKS 259
             .:||:.|.|
 Frog   279 -PTELNCGHS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 52/211 (25%)
rad51dNP_001005687.1 P-loop_NTPase 82..298 CDD:393306 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.