DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51b

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_998577.1 Gene:rad51b / 406721 ZFINID:ZDB-GENE-040426-2750 Length:373 Species:Danio rerio


Alignment Length:280 Identity:74/280 - (26%)
Similarity:118/280 - (42%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SQPEAIERRPSVSHENFRIFDKSC----------WDISQSASNKILTGKKALDTHFGGGISLGHL 66
            |.|.|:..:        |:..|:|          |...:...  ..|...|||....||:..|.|
Zfish    45 SYPAALNLQ--------RLVSKACAPAVITALDLWKRKEELC--FSTSLPALDRLLHGGLPRGAL 99

  Fly    67 VELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVP 131
            .|:.|.||.||||:|:.|.:...:||:.|||:...::|||...|..:||:.:|       ..|.|
Zfish   100 TEVTGPSGCGKTQLCMMLSVLATLPKSLGGLDSGVIYIDTESAFSAERLVEMA-------QSRFP 157

  Fly   132 EFKAHK-----MLQKIHYVR---C----PKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRM 184
            ||.:.|     |..::|..|   |    .:|::|...:::|...||        ::||:|..:|.
Zfish   158 EFFSVKERLLEMAARVHLFRELTCQDVLKRLERLEEDIIACRAGLV--------ILDSVASVVRK 214

  Fly   185 LEDGA------HRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQKFQ-------------- 229
            ..|.:      ||...|.:....::.|.::..:..|.||.:| .:|.:|..              
Zfish   215 EFDTSLPGNLTHRSNFLGQEAAVLKYLSQEFCIPVVLTNQIT-THVGEKLHCPQWNQTDASFEED 278

  Fly   230 ---VEPALGDLHSHLINERI 246
               |..|||:..||.:|.|:
Zfish   279 SGFVTAALGNTWSHSVNTRL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 67/236 (28%)
rad51bNP_998577.1 Rad51 65..332 CDD:285604 68/252 (27%)
Rad51_DMC1_radA 79..333 CDD:238543 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.