DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and rad51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_998371.2 Gene:rad51 / 406487 ZFINID:ZDB-GENE-040426-2286 Length:340 Species:Danio rerio


Alignment Length:244 Identity:69/244 - (28%)
Similarity:109/244 - (44%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109
            :|.||.|.||....|||..|.:.|:.|...|||||:|..|.:..|:|...||.||.|::|||...
Zfish   102 QISTGSKELDKLLQGGIETGSITEMFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKAMYIDTEGT 166

  Fly   110 FHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLD---QLM---ATVLSCHRHLVDHP 168
            |.|:||:.:|    .:|.     .....:|..:.|.|....|   ||:   :.:::..|:     
Zfish   167 FRPERLLAVA----ERYG-----LVGSDVLDNVAYARAFNTDHQTQLLYQASAMMTESRY----- 217

  Fly   169 DIKLIVIDSLAFTLRMLEDGAHRYEMLL---ELHESMRRLQRQHELTWVFTNVLTHRYVKQ---- 226
              .|:::||.....|  .|.:.|.|:..   .|...:|.|.|..:...|.. |:|::.|.|    
Zfish   218 --ALLIVDSATALYR--TDYSGRGELSARQGHLGRFLRMLLRLADEFGVAV-VITNQVVAQVDGA 277

  Fly   227 -KFQVEPAL---GDLHSHLINERIWF-SGSSELHLGKSWRTSRLIKESE 270
             .|..:|..   |::.:|....|::. .|..|..:.|.: .|..:.|:|
Zfish   278 AMFSADPKKPIGGNILAHASTTRLYLRKGRGETRICKIY-DSPCLPEAE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 63/220 (29%)
rad51NP_998371.2 recomb_RAD51 26..340 CDD:274048 69/244 (28%)
HHH_5 32..81 CDD:291205
Rad51_DMC1_radA 103..336 CDD:238543 69/243 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.