DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Rad51D

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610466.2 Gene:Rad51D / 35937 FlyBaseID:FBgn0033389 Length:336 Species:Drosophila melanogaster


Alignment Length:210 Identity:53/210 - (25%)
Similarity:86/210 - (40%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAH 128
            |.:.||.|..|.||||:...|.||.....:.     :.|||||:::|...|:..:.      .|.
  Fly    99 GRVWELCGQPGVGKTQLLYTLALNFVWKHSQ-----AVLFIDTKREFSCKRIQDML------RAR 152

  Fly   129 RVPEFKAHKMLQKIHYVRC---PKLDQLMATV---LSCHRHLVDHPDIKLIVIDSLA-----FTL 182
            .|.|..:.:.::.|..|:.   ..::.|:.:.   |:...|.  ....||::|||||     :..
  Fly   153 EVDEEASERAMKGIRVVQAATGADINDLLKSFDHQLTAETHA--SMQTKLVLIDSLAACFAFYRG 215

  Fly   183 RMLEDGAHRYEMLLELHESMRRLQRQHELTWVFTNVLTHRYVKQ----------------KFQVE 231
            |.:.|  .|..:|.||...:|:|..: .:.:|..||......|.                :.|:|
  Fly   216 RRMRD--VRKSVLTELACKIRKLALR-GVAFVIGNVSFFENNKDSCGDDGEQNGDDEEVTRQQLE 277

  Fly   232 PALGDLHSHLINERI 246
            |.||...|.:...|:
  Fly   278 PMLGSYWSSVATLRL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 53/210 (25%)
Rad51DNP_610466.2 P-loop_NTPase 80..336 CDD:304359 53/210 (25%)
radB 80..335 CDD:236482 53/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.