DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Rad51b

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_030102481.1 Gene:Rad51b / 19363 MGIID:1099436 Length:381 Species:Mus musculus


Alignment Length:176 Identity:49/176 - (27%)
Similarity:81/176 - (46%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HENFRIFDKSCWDISQSASNK------------ILTGKKALDTHFGGGISLGHLVELIGNSGTGK 77
            ||......|:|....|:|...            :.|...|||....||:..|.|.|:.|..|.||
Mouse    61 HELLHTVSKACAPQMQTAYELKTRRSAHLSPAFLSTTLCALDEALHGGVPCGSLTEITGPPGCGK 125

  Fly    78 TQMCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEF--KAHKML- 139
            ||.|:.:.:...:|.:.|||||:.::|||...|..:||:.:|       ..|.|::  ...|:| 
Mouse   126 TQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIA-------ESRFPQYFNTEEKLLL 183

  Fly   140 --QKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLR 183
              .::|..|....:.|:..:.|....::. ..:||:::||:|..:|
Mouse   184 TSSRVHLCRELTCEGLLQRLESLEEEIIS-KGVKLVIVDSIASVVR 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 43/143 (30%)
Rad51bXP_030102481.1 Rad51_DMC1_radA 94..369 CDD:238543 43/143 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1065
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.