DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Rad51

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_035364.1 Gene:Rad51 / 19361 MGIID:97890 Length:339 Species:Mus musculus


Alignment Length:238 Identity:67/238 - (28%)
Similarity:105/238 - (44%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109
            :|.||.|.||....|||..|.:.|:.|...|||||:|..|.:..|:|...||.||.|::|||...
Mouse   101 QITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGT 165

  Fly   110 FHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIKLIV 174
            |.|:||:.:|    .:|.     .....:|..:.|.|....|.....:......:|: ....|::
Mouse   166 FRPERLLAVA----ERYG-----LSGSDVLDNVAYARGFNTDHQTQLLYQASAMMVE-SRYALLI 220

  Fly   175 IDSLAFTLRMLEDGAHRYEM---LLELHESMRRLQRQHELTWVFTNVLTHRYVKQ-----KFQVE 231
            :||.....|  .|.:.|.|:   .:.|...:|.|.|..:...|.. |:|::.|.|     .|..:
Mouse   221 VDSATALYR--TDYSGRGELSARQMHLARFLRMLLRLADEFGVAV-VITNQVVAQVDGAAMFAAD 282

  Fly   232 PAL---GDLHSHLINERIWF-SGSSELHLGKSWRTSRLIKESE 270
            |..   |::.:|....|::. .|..|..:.|.: .|..:.|:|
Mouse   283 PKKPIGGNIIAHASTTRLYLRKGRGETRICKIY-DSPCLPEAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 61/214 (29%)
Rad51NP_035364.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
recomb_RAD51 25..339 CDD:274048 67/238 (28%)
Interaction with PALB2. /evidence=ECO:0000250 184..257 16/75 (21%)
Nuclear export signal, masked by the interaction with BRCA2. /evidence=ECO:0000250|UniProtKB:Q06609 245..260 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22942
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.