DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and Dmc1

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_034189.1 Gene:Dmc1 / 13404 MGIID:105393 Length:340 Species:Mus musculus


Alignment Length:259 Identity:67/259 - (25%)
Similarity:100/259 - (38%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ERRPSVSHENFRIFDKSCWDISQSASNKILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCL 82
            |||..|.|                    |.||.:..|...||||....:.|..|...|||||:..
Mouse    93 ERRKMVFH--------------------ITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSH 137

  Fly    83 QLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRC 147
            .||:..|:|...|...|..:||||...|.||||..:|.:....:         ..:|..:.|.|.
Mouse   138 TLCVTAQLPGTGGYSGGKIIFIDTENTFRPDRLRDIADRFNVDH---------EAVLDNVLYARA 193

  Fly   148 PKLDQLMATVLSCHRHLVD------HPD---IKLIVIDSLAFTLRMLEDG----AHRYEMLLELH 199
            ...:..|        .|:|      |.:   .||::|||:....|:...|    |.|.:.|.::.
Mouse   194 YTSEHQM--------ELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQML 250

  Fly   200 ESMRRLQRQHELTWVFTNVLT-HRYVKQKFQVEPAL---GDLHSHLINERIWF-SGSSELHLGK 258
            ..::::..::.:....||.:| .......||.:|..   |.:.:|....||.. .|..||.:.|
Mouse   251 SRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 58/220 (26%)
Dmc1NP_034189.1 recomb_DMC1 24..338 CDD:131292 67/259 (26%)
HHH_5 25..79 CDD:291205
Rad51_DMC1_radA 101..336 CDD:238543 62/231 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.