DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-D and DMC1

DIOPT Version :9

Sequence 1:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011528136.1 Gene:DMC1 / 11144 HGNCID:2927 Length:362 Species:Homo sapiens


Alignment Length:283 Identity:73/283 - (25%)
Similarity:110/283 - (38%) Gaps:64/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EAIERRPSVSHENFRIFDKSCWDISQSASNKILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQ 79
            |..|:|..|.|                    |.||.:..|...||||....:.|..|...|||||
Human    90 EYSEKRKMVFH--------------------ITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQ 134

  Fly    80 MCLQLCLNVQIPKAAGGLEGSALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHY 144
            :...||:..|:|.|.|...|..:||||...|.||||..:|.:....:         ..:|..:.|
Human   135 LSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDH---------DAVLDNVLY 190

  Fly   145 VRCPKLDQLMATVLSCHRHLVD------HPD---IKLIVIDSLAFTLRMLEDG----AHRYEMLL 196
            .|....:..|        .|:|      |.:   .||::|||:....|:...|    |.|.:.|.
Human   191 ARAYTSEHQM--------ELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLA 247

  Fly   197 ELHESMRRLQRQHELTWVFTNVLT-HRYVKQKFQVEPAL---GDLHSHLINERIWF-SGSSELHL 256
            ::...::::..::.:....||.:| .......||.:|..   |.:.:|....||.. .|..||.:
Human   248 QMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRI 312

  Fly   257 GKSW-RTS--------RLIKESE 270
            .|.: |.|        :.||:.|
Human   313 AKIYDRLSEREQKASVKTIKDPE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 59/220 (27%)
DMC1XP_011528136.1 recomb_DMC1 24..329 CDD:131292 70/275 (25%)
HHH_5 25..79 CDD:291205
Rad51_DMC1_radA 101..317 CDD:238543 63/232 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.