DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and Asic1

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006257440.1 Gene:Asic1 / 79123 RGDID:71062 Length:559 Species:Rattus norvegicus


Alignment Length:460 Identity:95/460 - (20%)
Similarity:158/460 - (34%) Gaps:166/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VTFYHTLPFFANVSLSLLNSYLSSSVSFNLDTIYLNWNSTFPAITVCEIYNAERIWDLSDSN--- 69
            |.:|.:.|     .::||:...::.:             .|||:|.|.. ||.|:..||..:   
  Rat   110 VAYYLSYP-----HVTLLDEVATTEL-------------VFPAVTFCNT-NAVRLSQLSYPDLLY 155

  Fly    70 ----FGVEHDMHVDDFISEIVFYRGVCSSCEDCSRMRCPSNFT----HLVDVFRTKCHQL---LV 123
                .|::..   ||        .||..:...      |..|:    :|...:...||:|   |:
  Rat   156 LAPMLGLDES---DD--------PGVPLAPPG------PEAFSGEPFNLHRFYNRSCHRLEDMLL 203

  Fly   124 NCTYLNKLFDC---C--DQFLPLPTEYGLCFSFNSHQARKVSHLQFTNNRMTGPGHLSFHAAADI 183
            .|:|      |   |  ..|..:.|.||.|::|||.|..: ..|: |....||.|   .....||
  Rat   204 YCSY------CGGPCGPHNFSVVFTRYGKCYTFNSGQDGR-PRLK-TMKGGTGNG---LEIMLDI 257

  Fly   184 QLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDES---VQDL------------SME 233
            |...:.|:       .|...||......|      :::|:.:.   :..|            |.:
  Rat   258 QQDEYLPV-------WGETDETSFEAGIK------VQIHSQDEPPFIDQLGFGVAPGFQTFVSCQ 309

  Fly   234 QRRCRYGHEHVPERQG----------IYDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYLP 288
            ::|..|    :|...|          .:|.||.:.|.::|.....::||||  ..:.:||.  .|
  Rat   310 EQRLIY----LPSPWGTCNAVTMDSDFFDSYSITACRIDCETRYLVENCNC--RMVHMPGD--AP 366

  Fly   289 VCDVRGL-ICLTRIRDKIM-TERKSCECMSSCEEPEYNIIYNSADEDDEASDEVSEIRVALVELP 351
            .|..... .|.....|.:: .:::.|.|...|....|             ..|:|     :|::|
  Rat   367 YCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRY-------------GKELS-----MVKIP 413

  Fly   352 TQRYVRRVTK-------------TILD---------------------FLISLGGLVGLFFNTSA 382
            ::...:.:.|             .:||                     .|..:||.:|||...|.
  Rat   414 SKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASI 478

  Fly   383 LRIVE 387
            |.::|
  Rat   479 LTVLE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 66/325 (20%)
Asic1XP_006257440.1 ASC 63..541 CDD:295594 95/460 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.