DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and Asic5

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_067345.1 Gene:Asic5 / 58170 MGIID:1929259 Length:495 Species:Mus musculus


Alignment Length:443 Identity:108/443 - (24%)
Similarity:180/443 - (40%) Gaps:110/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YLNWNST------------FPAITVCEIYNAERIWDLSDSNFGVEHDMHVDDFISEIVFYRGVCS 93
            |..|.:|            |||:|:|   |..|....:.|.||:  ...:.|.:|:::..:.:.:
Mouse    87 YFTWPTTTSIEVQYVEKIEFPAVTLC---NLNRFQTEAVSRFGI--IFFLWDIVSKVLRLQEISA 146

  Fly    94 ----SCEDCSRMRCPSNFTHLVDVFRTKCHQL----LVNCTYLNKLFDCCDQFLPLPTEYGLCFS 150
                |.|....:....||: :.:..:.....|    ||:|.:..|.....| |..:.||||.||:
Mouse   147 NNTGSPETLDFVTNHQNFS-ITEFVKNNGFYLNNDTLVHCEFFGKTCSPKD-FKHVFTEYGNCFT 209

  Fly   151 F----NSHQARKVS-------------HLQFTNNRMTGPGHLSFHAAADIQLYVHAPIDVPYQFS 198
            |    |.....|||             ..:||:|.:.|      .|.|.:...:|:|...| || 
Mouse   210 FNYGENIQNKNKVSVSGRGLKLLLDVHQEEFTDNPVPG------FADAGVIFVIHSPKKEP-QF- 266

  Fly   199 EGMIRETVLLGHYKELILNVIEVHNDESVQDLSMEQRRCRYGHEHVPERQGIYDFYSYS--GCVV 261
            :|       ||     :.:.:.:|...:::.|....:...:| |..|..: :.:|.:||  ||:.
Mouse   267 DG-------LG-----LSSPVGMHARVTIRQLKTVHQEYPWG-ECNPNIK-LRNFITYSTYGCLK 317

  Fly   262 ECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVRGLI-CLTRIRDKIMTERK--------SCECMSS 317
            ||........|.|..  ..:||...  .||:.... |::.|.|.|  |||        :..|..|
Mouse   318 ECKARHIQRLCGCLP--FLLPGNGV--ECDLLEYYNCVSPILDHI--ERKGLCTMGTHNSSCPVS 376

  Fly   318 CEEPEY--NIIYNS----------ADEDDEASDEVSEIRVALVELPTQRYVRRVTK-----TILD 365
            |||.||  .:.|::          |.:.:::.:.:.| .:..:|:.......::|:     ::.:
Mouse   377 CEETEYPATVSYSTFPSQRATRFLAKKLNQSQEYIRE-NLVNIEINYSDLNYKITQQQKAVSVPE 440

  Fly   366 FLISLGGLVGLFFNTSALRIVETIVICLRYRKTIVKWVKRFFLGTVQYLQILD 418
            .|..:||.:|||...|.:.|:|.|    .|..|...||..|||     |:||:
Mouse   441 LLADVGGQLGLFCGASLITIIEII----EYFFTNFYWVLIFFL-----LKILE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 73/304 (24%)
Asic5NP_067345.1 ASC 41..466 CDD:366339 98/418 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.