DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ASIC5

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:467 Identity:114/467 - (24%)
Similarity:189/467 - (40%) Gaps:112/467 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILYLVTFYHTLPFFA-NVSLSLLNSYLSSSVSFNLDTIYLNWNSTFPAITVCEIYNAERIWDLSD 67
            :|:||....::.... .:.:.||| |.:...:.:::..|:. ...|||:|.|   |..|....:.
Human    63 VLWLVVVLGSVSLVTWQIYIRLLN-YFTWPTTTSIEVQYVE-KMEFPAVTFC---NLNRFQTDAV 122

  Fly    68 SNFGVEHDM-HVDDFISEIVFYRGVCS----SCEDCSRMRCPSNFTHLVDVFRTKCHQL----LV 123
            :.|||...: |:   :|:::..:.:.:    |.|.........||: :|:..|.|...|    |:
Human   123 AKFGVIFFLWHI---VSKVLHLQEITANSTGSREATDFAASHQNFS-IVEFIRNKGFYLNNSTLL 183

  Fly   124 NCTYLNKLFDCCDQ-FLPLPTEYGLCFSFNSHQA----RKVS-------------HLQFTNNRMT 170
            :|.:..|  .|..: |..:.||||.||:||..:.    ||||             ...||:|...
Human   184 DCEFFGK--PCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPAL 246

  Fly   171 GPGHLSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDESVQDLSMEQR 235
            |      ...|.|...:|:|..|| || :|       ||     :|:.:.:|...:::.:....:
Human   247 G------FVDAGIIFVIHSPKKVP-QF-DG-------LG-----LLSPVGMHARVTIRQVKTVHQ 291

  Fly   236 RCRYGHEHVPERQGIYDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVRGLI-CLT 299
            ...:|..:...:...:..||.|||:.||........|.|..  ..:||  |...||::... |::
Human   292 EYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVP--FLLPG--YGIECDLQKYFSCVS 352

  Fly   300 RIRDKIM--------TERKSCECMSSCEEPEY--NIIYNSADEDDE---ASDEVSEIRVALVELP 351
            .:.|.|.        |...||..  ||||.||  .|.|:|......   .|.::::.|       
Human   353 PVLDHIEFKDLCTVGTHNSSCPV--SCEEIEYPATISYSSFPSQKALKYLSKKLNQSR------- 408

  Fly   352 TQRYVR---------------RVTK-----TILDFLISLGGLVGLFFNTSALRIVETIVICLRYR 396
              :|:|               ::|:     ::.:.|..|||.:|||...|.:.|:|.|    .|.
Human   409 --KYIRENLVKIEINYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEII----EYL 467

  Fly   397 KTIVKWVKRFFL 408
            .|...|:..|||
Human   468 FTNFYWICIFFL 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 76/311 (24%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 108/452 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.