DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and ASIC1

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_064423.2 Gene:ASIC1 / 41 HGNCID:100 Length:574 Species:Homo sapiens


Alignment Length:393 Identity:78/393 - (19%)
Similarity:138/393 - (35%) Gaps:119/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TFPAITVC-------------EIYNAERIWDLSDSNFGVEHDMHVDDFISEIVFYRGVCSSCEDC 98
            ||||:|:|             ::|:|..:..|.::.:.:......|:...||:         :|.
Human    86 TFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEIL---------QDK 141

  Fly    99 SRMRC----PSNFTHLVDVFRTKCHQLLVNCTYLNKLFDC-CDQFLPLPTEYGLCFSFNSHQARK 158
            :..|.    |.|.....|........:|::|.:..::  | .:.|..:.|.||.|::|||.:..:
Human   142 ANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEV--CSAEDFKVVFTRYGKCYTFNSGRDGR 204

  Fly   159 VSHLQFTNNRMTGPGHLSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHN 223
             ..|: |....||.|   .....|||...:.|:       .|...||......|      :::|:
Human   205 -PRLK-TMKGGTGNG---LEIMLDIQQDEYLPV-------WGETDETSFEAGIK------VQIHS 251

  Fly   224 DES---VQDLS-------------MEQRRCRYGHEHVPERQG------------IYDFYSYSGCV 260
            .:.   :..|.             .|||..     ::|...|            .:|.||.:.|.
Human   252 QDEPPFIDQLGFGVAPGFQTFVACQEQRLI-----YLPPPWGTCKAVTMDSDLDFFDSYSITACR 311

  Fly   261 VECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVRGL-ICLTRIRDKIM-TERKSCECMSSCEEPEY 323
            ::|.....::||||  ..:.:||.  .|.|..... .|.....|.:: .:::.|.|...|....|
Human   312 IDCETRYLVENCNC--RMVHMPGD--APYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRY 372

  Fly   324 NIIYNSADEDDEASDEVSEIRVALVELPTQRYVRRVTKTILDFLISLGGLVGLFFNTSALRIVET 388
                         ..|:|     :|::|::...:.:.|.               ||.|...|.|.
Human   373 -------------GKELS-----MVKIPSKASAKYLAKK---------------FNKSEQYIGEN 404

  Fly   389 IVI 391
            |::
Human   405 ILV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 57/290 (20%)
ASIC1NP_064423.2 ENaC 19..556 CDD:273304 78/393 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.