DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and asic4a

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_999952.1 Gene:asic4a / 407668 ZFINID:ZDB-GENE-040513-5 Length:539 Species:Danio rerio


Alignment Length:472 Identity:104/472 - (22%)
Similarity:174/472 - (36%) Gaps:150/472 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LYLVTFYHTLPFFANVSLSLLNSYLSSSVSFNLDTIYLNWNST----FPAITVCEIYNAERIWDL 65
            |:.:.|..:|..|...:.....|||.     :.....||..:|    |||:|:|.| |..|...|
Zfish    68 LWALAFLVSLALFLYQAAKCAISYLE-----HPHVTALNEEATPEMVFPAVTICNI-NRFRFSAL 126

  Fly    66 SDSNFGVEHDMHVDDFISEIVFYRGVCSSCEDCSRMRCPSNFTH----LVDVFRTKCHQL---LV 123
            :|::            |..:....|:....:|..:   |::..:    :.|:|....|||   |.
Zfish   127 TDAD------------IYHLANLTGLPPKNKDGHK---PTDLEYPAPDMQDIFNRTGHQLEEMLK 176

  Fly   124 NCTYLNKLFDC-CDQFLPLPTEYGLCFSFNSHQARKVSHLQFTNNRMTGPGHL--SFHAAADIQL 185
            :|.:..:  :| .:.|..:.|.||.|::||.::         |.:|.|..|.:  ......|||.
Zfish   177 SCNFSGQ--NCSAEDFTVVYTRYGKCYTFNGNK---------TTSRKTKQGGMGNGLEIMLDIQQ 230

  Fly   186 YVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIEVHNDES---VQDL------------SMEQR 235
            ..:.||     :.|  ..||.|....:      :::|:.:.   :..|            |.:::
Zfish   231 DDYLPI-----WKE--TNETSLEAGIR------VQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQ 282

  Fly   236 RCRY-----GHEHVPERQGI--YDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPGQNYLPVCDVR 293
            |..|     |:......|.|  ||.||.|.|.:.|..|..|..|.|  ..:.:||.  ..:|...
Zfish   283 RLTYLPQPWGNCRSTSEQMIPGYDTYSISACRLRCETLEVLRECKC--RMVHMPGD--ANICTPS 343

  Fly   294 GLICLTRIRDKIM-----TERKSCECMSSCEEPEYNIIYNSADEDDEASDEVSEIRVALVELPTQ 353
            .:.|:    ||.:     :...:|.|.:.|....|             ..|:|     :|::|::
Zfish   344 DIKCV----DKALALLQKSSGDTCFCETPCNLTRY-------------GKELS-----MVKIPSK 386

  Fly   354 ---RYV-RRVTKT---------ILD---------------------FLISLGGLVGLFFNTSALR 384
               ||: |:..|:         :||                     .|..:||.:|||...|.|.
Zfish   387 GSARYLSRKYDKSEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLT 451

  Fly   385 IVETIVICLRYRKTIVK 401
            |:|    .|.|...::|
Zfish   452 ILE----ILDYVYEVIK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 69/323 (21%)
asic4aNP_999952.1 ASC 44..472 CDD:295594 104/472 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.