DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk31 and asic4b

DIOPT Version :9

Sequence 1:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:433 Identity:98/433 - (22%)
Similarity:154/433 - (35%) Gaps:151/433 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TFPAITVCEIYNAERIWDLSDSNFGVEHDMHVDDFISEIVFYRGVCSSCEDCSRM-RCPSNFTH- 109
            ||||||:|.: |..|...|:|::                :::....:.....||. ..||...: 
Zfish   113 TFPAITLCNV-NRFRFSALTDAD----------------IYHLANLTGLPPKSRKGHRPSELQYP 160

  Fly   110 ---LVDVFRTKCHQL---LVNCTYLNKLFDC-CDQFLPLPTEYGLCFSFNSHQA--RKVSHLQFT 165
               ::|:|:...|||   |.:|.:..:  :| .:.|..:.|.||.|::||.::.  ::|      
Zfish   161 PPNMLDIFQRTGHQLEDMLKSCNFSGQ--NCSSEDFSVVYTRYGKCYTFNGNKTSPKRV------ 217

  Fly   166 NNRMTGPGHLSFHAAADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNV---IEVHNDES- 226
              |..|.|: ......|||...:.||          .|||      .|..|..   :::|:... 
Zfish   218 --RQGGTGN-GLEMMLDIQQDEYLPI----------WRET------NETTLEAGIRVQIHSQNEP 263

  Fly   227 --VQDLS-------------MEQR---------RCRYGHEHVPERQGIYDFYSYSGCVVECTVLL 267
              :..|.             .|||         .||...|  |...| ||.||.|.|.:.|....
Zfish   264 PYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRASSE--PVIPG-YDTYSVSACRLHCESTQ 325

  Fly   268 QLDNCNCTSHFMAIPGQNYLPVCDVRGLICLTRIRDKIMTERK-----SCECMSSCEEPEYNIIY 327
            ....|||  ..:.:||.  ..:|....:.|:    ||.:...:     ||.|.:.|....|    
Zfish   326 VQRECNC--RMVHMPGD--ADICAPSKIKCV----DKALASLQKSTGDSCPCETPCNLTRY---- 378

  Fly   328 NSADEDDEASDEVSEIRVALVELPTQ---RYV-RRVTKT---------ILD-------------- 365
                     ..|:|     :|::|::   ||: |:..|:         |||              
Zfish   379 ---------GKELS-----MVKIPSRGSARYLSRKYQKSEEYIRDNFLILDIFFEALNYETIEQK 429

  Fly   366 -------FLISLGGLVGLFFNTSALRIVETIVICLRYRKTIVK 401
                   .|..:||.:|||...|.|.|:|.:.......|..:|
Zfish   430 KAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKIK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk31NP_001097944.1 ASC <127..387 CDD:279230 73/329 (22%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 98/433 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.